PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo12G0025200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 420aa    MW: 46674.1 Da    PI: 7.0824
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo12G0025200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS387.71.3e-118374182374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      +el+++cA+ vs g+l +a+++++ ls  asp gd++ Rla+ f +AL+ r++r  + l++a ++   ++ + +   +a+ ++++v+P+++f+h
  Spipo12G0025200  37 RELMITCADLVSRGNLPAARHAISLLSAAASPCGDSVDRLAHLFSRALSLRVSR--QALASAAASPVLPPPDPDALQSAYLMLNQVTPFIRFCH 128
                      7899**************************************************..55555555555555577888889999************ PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl...... 181
                      ltaNqaIleav+g + +Hi+Dfd  +G+QWp+Llqa+a+R   ++ ps+RiTg g     + ++l++tgerL+ fA++lg++f+f +l      
  Spipo12G0025200 129 LTANQAILEAVDGRRSIHILDFDTAHGVQWPPLLQAIAERYdaANRPSIRITGTGT----DLNTLHRTGERLKCFAQSLGLRFQFFPLllpstg 218
                      ****************************************987889**********....9**************************9999888 PP

             GRAS 182 .........vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                               + ++   ++l++++++pgE+laVn+vl lh+ll   ++ + e++ +L+++k ++P vv+v+e+ea+hns+ Fl+rf+ a+++y+a
  Spipo12G0025200 219 imssvdpsgIDSSSGFFNLSAFQLHPGETLAVNCVLFLHKLL---GADSTEIQPFLRAIKAMKPAVVTVAEREANHNSPVFLHRFMGAVDHYTA 309
                      77776666555566667999999999****************...444444679**************************************** PP

             GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv 359
                      +f+slea+lp+ s+er +vE++++grei +vva+eg+errerhe++e+W+++l  aGF ++pls +  +qaklllr ++  +gy+++  ++sl+
  Spipo12G0025200 310 MFESLEATLPASSQERLTVEQVWFGREIADVVAAEGDERRERHERFERWERALWGAGFANLPLSPFSLSQAKLLLRIHYpLEGYHLQMVKDSLF 403
                      ********************************************************************************************** PP

             GRAS 360 lgWkdrpLvsvSaWr 374
                      lgW++rpL+svS+Wr
  Spipo12G0025200 404 LGWRGRPLFSVSSWR 418
                      **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.36110397IPR005202Transcription factor GRAS
PfamPF035144.5E-11637418IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010014Biological Processmeristem initiation
GO:0010223Biological Processsecondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MLSSLNSHDE EDDSDHHHRP HHLHHHHGFI TQSTHIRELM ITCADLVSRG NLPAARHAIS  60
LLSAAASPCG DSVDRLAHLF SRALSLRVSR QALASAAASP VLPPPDPDAL QSAYLMLNQV  120
TPFIRFCHLT ANQAILEAVD GRRSIHILDF DTAHGVQWPP LLQAIAERYD AANRPSIRIT  180
GTGTDLNTLH RTGERLKCFA QSLGLRFQFF PLLLPSTGIM SSVDPSGIDS SSGFFNLSAF  240
QLHPGETLAV NCVLFLHKLL GADSTEIQPF LRAIKAMKPA VVTVAEREAN HNSPVFLHRF  300
MGAVDHYTAM FESLEATLPA SSQERLTVEQ VWFGREIADV VAAEGDERRE RHERFERWER  360
ALWGAGFANL PLSPFSLSQA KLLLRIHYPL EGYHLQMVKD SLFLGWRGRP LFSVSSWRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-626441831375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411905.10.0PREDICTED: protein MONOCULM 1-like
SwissprotQ9ZWC51e-126SCL18_ARATH; Scarecrow-like protein 18
TrEMBLD7UAV51e-158D7UAV5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g01930.t011e-158(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36533479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.11e-106GRAS family protein